PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.0G2T6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family bHLH
Protein Properties Length: 90aa    MW: 10379.8 Da    PI: 6.7924
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.0G2T6genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.33.2e-0916571455
                 HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                 ++iN+  ++L+ llP++ + ++ K s + iL++++ +I+ Lq
  Araip.0G2T6 16 NEINDLVSRLQVLLPHLNQRTNSKHSMSKILQETCSHIRRLQ 57
                 58**************879**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.534256IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.79E-91674IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.0E-61657IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.2E-91771IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MSGQRSSTTG SKLTENEIND LVSRLQVLLP HLNQRTNSKH SMSKILQETC SHIRRLQKEV  60
DDLSERLALL MDSMDISDVD RRVLENFLQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140557.11e-36hypothetical protein PHAVU_008G122600g
TrEMBLA0A0B2PI039e-42A0A0B2PI03_GLYSO; Transcription factor bHLH135
TrEMBLK7LAU29e-42K7LAU2_SOYBN; Uncharacterized protein
STRINGGLYMA08G47171.12e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106242439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47710.15e-20BANQUO 3